PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK05843.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 256aa    MW: 28805.3 Da    PI: 5.1007
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK05843.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-101044237
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                     ++W t E++ll++av+++G+++W++Ia ++  +Rt+
        PK05843.2 10 QPWCTLEELLLACAVNRHGTKNWDSIAMELS-NRTE 44
                     689999*************************.9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-7761IPR009057Homeodomain-like
SMARTSM007172.6E-6862IPR001005SANT/Myb domain
PfamPF002491.3E-81044IPR001005SANT/Myb domain
SuperFamilySSF466891.33E-61069IPR009057Homeodomain-like
CDDcd001674.11E-61160No hitNo description
PROSITE profilePS500906.4581160IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MAKEHETSVQ PWCTLEELLL ACAVNRHGTK NWDSIAMELS NRTESPWTPD TCKHRFDELK  60
RRFTSRNDDE STSFLLIVDQ LKKIRLEELR REVRRHDVSI VSLELKVKRL EEEREKSLKE  120
ENEDKINLEE NERRLNSPEN NLAVKSNSDS CDRENRSSDE SNSTSRRNGA VKSETEPEPE  180
RINDSDPPRP ESEPGKVVNG DENETMAARG EDNTKQSSDV QSSMSLSKSK RSRKRSGAEA  240
GAGAGSGAAA VSSSGX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087384.11e-72hypothetical protein L484_018410
TrEMBLW9QD951e-72W9QD95_9R
STRINGPOPTR_0003s21840.11e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18702972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.12e-14DNA-binding bromodomain-containing protein